Recombinant Human INS Protein
Cat.No. : | INS-60H |
Product Overview : | Recombinant Human INS Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified, including insulin-dependent diabetes mellitus, permanent neonatal diabetes diabetes mellitus, maturity-onset diabetes of the young type 10 and hyperproinsulinemia. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. |
Form : | Liquid. In 1xPBS, pH 7.4. |
Molecular Mass : | ~11.9 kDa |
AA Sequence : | MFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGGIVEQCCTSICSLYQLENYCNPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.5 mg/ml |
Official Full Name : | Insulin |
Gene Name | INS insulin [ Homo sapiens (human) ] |
Official Symbol | INS |
Synonyms | IDDM; ILPR; IRDN; IDDM1; IDDM2; PNDM4; MODY10 |
Gene ID | 3630 |
mRNA Refseq | NM_000207 |
Protein Refseq | NP_000198 |
MIM | 176730 |
UniProt ID | P01308 |
◆ Recombinant Proteins | ||
INS-191HFL | Active Recombinant Full Length Human INS Protein, C-Flag-tagged | +Inquiry |
INS-5308H | Recombinant Human Insulin | +Inquiry |
INS-53H | Active Recombinant Human INS Protein | +Inquiry |
INS-1187H | Recombinant Human INS Protein, His (Fc)-Avi-tagged | +Inquiry |
INS-256H | Active Recombinant Human Insulin | +Inquiry |
◆ Native Proteins | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
0
Inquiry Basket