Recombinant Human INA, GST-tagged

Cat.No. : INA-829H
Product Overview : Recombinant Human INA (1 a.a. - 499 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
Molecular Mass : 81.8 kDa
AA Sequence : MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGL DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDL RAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELA FVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLENDLRNTKSEMARH LREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE EEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQKI
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Publications :
Epigenetic Inactivation of α-Internexin Accelerates Microtubule Polymerization in Colorectal Cancer (2020)
Gene Name INA internexin neuronal intermediate filament protein, alpha [ Homo sapiens (human) ]
Official Symbol INA
Synonyms INA; NEF5; NF-66; TXBP-1; internexin neuronal intermediate filament protein, alpha; alpha-internexin; alpha-Inx; neurofilament 5 (66kD); 66 kDa neurofilament protein; neurofilament-66, tax-binding protein
Gene ID 9118
mRNA Refseq NM_032727
Protein Refseq NP_116116
MIM 605338
UniProt ID Q16352
Chromosome Location 10q24.33
Function structural constituent of cytoskeleton

Epigenetic Inactivation of α-Internexin Accelerates Microtubule Polymerization in Colorectal Cancer

Journal: Cancer Research    Data: 2020/10/13

Authors: Yingjie Li, Liangliang Bai, Yanxin Luo

Article Snippet:To determine the activity of INA and tubulin-binding peptides on microtubule polymerization, 3 mg/ml pure tubulin proteins were diluted in the tubulin polymerization buffer and pipetted into the half area 96- well plates.To determine the activity of INA and tubulin-binding peptides on microtubule polymerization, 3 mg/ml pure tubulin proteins were diluted in the tubulin polymerization buffer and pipetted into the half area 96- well plates.. Recombinant GST-tagged INA (Creative BioMart, Shirley, NY) , GST (Sino Biological), custom-created peptides (Sangon), and nocodazole (Selleck, Houston, TX) were added to the mixtures.. Signals were recorded within 60 minutes after reaction initiation according to OD-based measurements taken every minute with a Varioskan Flash reader (Thermo, Waltham, MA) at 37 °C.Signals were recorded within 60 minutes after reaction initiation according to OD-based measurements taken every minute with a Varioskan Flash reader (Thermo, Waltham, MA) at 37 °C.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INA Products

Required fields are marked with *

My Review for All INA Products

Required fields are marked with *

0
cart-icon
0
compare icon