Recombinant Full Length Human INA Protein, GST-tagged

• Cat.No.: INA-6955HF
• Product Overview: Recombinant full-length Human INA (1 a.a. - 499 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 499 amino acids
• Description: Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
• Molecular Mass: 81.8 kDa
• AA Sequence: MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGL DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDL RAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELA FVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLENDLRNTKSEMARH LREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE EEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQKI
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INA internexin neuronal intermediate filament protein, alpha [ Homo sapiens (human) ]
• Official Symbol: INA
• Synonyms: INA; NEF5; NF-66; TXBP-1; internexin neuronal intermediate filament protein, alpha; alpha-internexin; alpha-Inx; neurofilament 5 (66kD); 66 kDa neurofilament protein; neurofilament-66, tax-binding protein
• Gene ID: 9118
• mRNA Refseq: NM_032727
• Protein Refseq: NP_116116
• MIM: 605338
• UniProt ID: Q16352