Recombinant Human IMPA1 protein(11-270 aa), C-His-tagged

• Cat.No.: IMPA1-2712H
• Product Overview: Recombinant Human IMPA1 protein(P29218)(11-270 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-270 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: ADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

Gene Information

• Gene Name: IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 [ Homo sapiens ]
• Official Symbol: IMPA1
• Synonyms: IMPA1; inositol(myo)-1(or 4)-monophosphatase 1; IMPA; inositol monophosphatase 1; IMP 1; IMPase 1; inositol-1(or 4)-monophosphatase 1; lithium-sensitive myo-inositol monophosphatase A1; IMP
• Gene ID: 3612
• mRNA Refseq: NM_001144878
• Protein Refseq: NP_001138350
• MIM: 602064
• UniProt ID: P29218