Recombinant Human IL21 Protein

• Cat.No.: IL21-117H
• Product Overview: Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Gln23-Ser155
• Description: IL-21 induces the production of IgG1 and IgG3 in B-cells. IL-21 may promote the transition between innate and adaptive immunity. IL-21 may have a role in proliferation and maturation of natural killer cells in synergy with IL15. IL-21 stimulates interferon gamma production in T-cells and natural killer cells by synergy with IL15 and IL18. Dysregulation of IL-21 has a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.2.
• AA Sequence: MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINV SIKKLKRKPPSTN AGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL21 interleukin 21 [ Homo sapiens (human) ]
• Official Symbol: IL21
• Synonyms: Interleukin-21; Za11; IL-21; CVID11
• Gene ID: 59067
• mRNA Refseq: NM_021803.4
• Protein Refseq: NP_068575.1
• MIM: 605384
• UniProt ID: Q9HBE4