Recombinant Human IGF1 therapeutic protein(Mecasermin)

• Cat.No.: IGF1-P059H
• Product Overview: IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human?IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human?IGF-1.

Specification

• Description: IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
• Source: E. coli
• Species: Human
• Molecular Mass: 76.5 Kda
• Protein length: 70 Aa
• AA Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Unit Definition: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Tag: Non
• Alias: IGF1; IGF1A; MGF; IGF-IA; IGF-IB; IGFI; IGF-I; Mecasermin

Gene Information

• Gene Name: IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ]
• Official Symbol: IGF1
• Synonyms: IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I
• Gene ID: 3479
• mRNA Refseq: NM_000618
• Protein Refseq: NP_000609
• MIM: 147440
• UniProt ID: P05019
• Chromosome Location: 12q23.2
• Pathway: Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dilated cardiomyopathy, organism-specific biosystem
• Function: growth factor activity; hormone activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; integrin binding; protein binding