Recombinant Human IFNL1, StrepII-tagged

• Cat.No.: IFNL1-299H
• Product Overview: Purified, full-length human recombinant IFNL1 (IL29) protein (amino acids 20-200, 181 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 20.0 kDa. (Accession NP_742152.1; UniProt Q8IU54)

Specification

• Species: Human
• Source: Human Cells
• Tag: StrepII
• ProteinLength: 20-200, 181 a.a.
• Description: This is a cytokine distantly related to type I interferons and the IL-10 family. This protein, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• AA Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAE LALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASV TFNLFRLLTRDLKYVADGNLCLRTSTHPEST
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.

Gene Information

• Gene Name: IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens ]
• Official Symbol: IFNL1
• Synonyms: IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29
• Gene ID: 282618
• mRNA Refseq: NM_172140
• Protein Refseq: NP_742152
• MIM: 607403
• UniProt ID: Q8IU54
• Chromosome Location: 19q13.13
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity; interleukin-28 receptor binding; receptor binding