Active Recombinant Mouse Ifng Protein, His-Tagged
Cat.No. : | Ifng-01M |
Product Overview : | Recombinant mouse Ifng Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Description : | Interferon-γ is a effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN-γ is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN-γ can upregulate expression of MHC class I and II antigen by antigen-presenting cells. |
Source : | Escherichia coli |
Species : | Mouse |
Tag : | His |
Form : | Lyophilized powder |
AA Sequence : | MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIA KFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus |
Endotoxin : | <0.01 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 10^6 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Ifng interferon gamma [ Mus musculus (house mouse) ] |
Official Symbol | Ifng |
Synonyms | Ifg; If2f; IFN-g |
Gene ID | 15978 |
mRNA Refseq | NM_008337.4 |
Protein Refseq | NP_032363.1 |
UniProt ID | P01580 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *
0
Inquiry Basket