Recombinant Human IFNG protein, hFc-Flag-tagged

• Cat.No.: IFNG-8665H
• Product Overview: Recombinant Human IFNG protein(P01579)(24-166aa), fused with N-terminal hFc and Flag tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&Flag
• Protein Length: 24-166aa
• Tag: N-hFc-Flag
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Gene Information

• Gene Name: IFNG interferon, gamma [ Homo sapiens ]
• Official Symbol: IFNG
• Synonyms: IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
• Gene ID: 3458
• mRNA Refseq: NM_000619
• Protein Refseq: NP_000610
• MIM: 147570
• UniProt ID: P01579