Specification
Gene Information
Related Products
Download

Description :	Human Interferon gamma (hIFN-γ) is amacrophage-activating factor and the lone member of Interferon type II. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.
Source :	CHO
Species :	Human
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 2 ng/mL, measured in a cytotoxicity assay using HT-29 cells, corresponding to a specific activity of > 5 × 10^5 units/mg.
Molecular Mass :	15-25 kDa, observed by non-reducing SDS-PAGE.
AA Sequence :	QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE and HPLC.
Storage :	Lyophilized recombinant Human Interferon gamma (IFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rh IFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	IFNG interferon, gamma [ Homo sapiens ]
Official Symbol	IFNG
Synonyms	IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID	3458
mRNA Refseq	NM_000619
Protein Refseq	NP_000610
MIM	147570
UniProt ID	P01579