Recombinant Full length Canine interferon gamma Protein, Tag Free

• Cat.No.: IFNG-33CFL
• Product Overview: The Canine IFN gamma recombinant protein was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

Specification

• Species: Canine
• Source: Yeast
• Tag: Non
• Protein Length: 1-166aa
• Description: Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called macrophage-activating factor, a term now used to describe a larger family of proteins to which IFN-gamma belongs. IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFN-gamma expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFN-gamma in the immune system stems in part from its ability to inhibit viral replication directly, but, most important, derives from its immunostimulatory and immunomodulatory effects. IFN-gamma is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 and CD8 cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops.
• Tag: Non
• Molecular Mass: 16.7 kDa
• AA Sequence: QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK(143)
• Applications: The Canine IFN gamma endotoxin-free recombinant protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.
• References: 1. TNF-α and INF-γ primed canine stem cell-derived extracellular vesicles alleviate experimental murine colitis. An JH, Li Q, Bhang DH, Song WJ, Youn HY. Sci Rep. 2020 Feb 7;10(1):2115. doi: 10.1038/s41598-020-58909-4.

Gene Information

• Gene Name: IFNG interferon gamma [ Canis lupus familiaris (dog) ]
• Official Symbol: IFNG
• Synonyms: IFNG; interferon gamma; IFN-G; IFN-gamma
• Gene ID: 403801
• mRNA Refseq: NM_001003174
• Protein Refseq: NP_001003174
• UniProt ID: P42161