Description :	This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases.
Species :	Human
Form :	Lyophilized
Protein length :	166
AA Sequence :	MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	IFNG interferon, gamma [ Homo sapiens (human) ]
Official Symbol	IFNG
Synonyms	IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID	3458
mRNA Refseq	NM_000619
Protein Refseq	NP_000610
MIM	147570
UniProt ID	P01579