Recombinant Rhesus IFNG protein
Cat.No. : | IFNG-74R |
Product Overview : | Recombinant Rhesus IFNG protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 142 |
Description : | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 20.0 ng/ml, corresponding to a specific activity of > 5.0×10⁴ IU/mg. |
Molecular Mass : | Approximately 16.8 kDa, a single non-glycosylated polypeptide chain containing 142 amino acids. |
AA Sequence : | QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ |
Endotoxin : | Less than 0.1 EU/µg of rRhIFN-γ as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNG |
Official Symbol | IFNG |
Synonyms | IFN-gamma |
Gene ID | 574282 |
mRNA Refseq | NM_001032905.1 |
Protein Refseq | NP_001028077.1 |
UniProt ID | P63310 |
◆ Recombinant Proteins | ||
IFNG-15833H | Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-3077M | Recombinant Marmota monax (Woodchuck) IFNG protein, His-tagged | +Inquiry |
ADPRH-2543H | Recombinant Human ADPRH protein, GST-tagged | +Inquiry |
IFNG-6015H | Active Recombinant Human IFNG protein | +Inquiry |
Ifng-118R | Recombinant Rat IFNG Protein, Fc-His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket