Recombinant Human HSF4

Cat.No. : HSF4-29388TH
Product Overview : Recombinant fragment of Human HSF4 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Sequence Similarities : Belongs to the HSF family.
Gene Name HSF4 heat shock transcription factor 4 [ Homo sapiens ]
Official Symbol HSF4
Synonyms HSF4; heat shock transcription factor 4; cataract, Marner , CTM; heat shock factor protein 4;
Gene ID 3299
mRNA Refseq NM_001040667
Protein Refseq NP_001035757
MIM 602438
Uniprot ID Q9ULV5
Chromosome Location 16q21
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSF4 Products

Required fields are marked with *

My Review for All HSF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon