Recombinant Human HSF4 Protein, GST-tagged

• Cat.No.: HSF4-5091H
• Product Overview: Human HSF4 partial ORF ( NP_001529, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSF4 heat shock transcription factor 4 [ Homo sapiens ]
• Official Symbol: HSF4
• Synonyms: HSF4; heat shock transcription factor 4; cataract, Marner , CTM; heat shock factor protein 4; HSF 4; hHSF4; HSTF 4; CTM
• Gene ID: 3299
• mRNA Refseq: NM_001040667
• Protein Refseq: NP_001035757
• MIM: 602438
• UniProt ID: Q9ULV5