Recombinant Human HOXA1 Protein, GST-tagged
Cat.No. : | HOXA1-4937H |
Product Overview : | Human HOXA1 full-length ORF ( AAH32547, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq |
Molecular Mass : | 62.48 kDa |
AA Sequence : | MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA1 homeobox A1 [ Homo sapiens ] |
Official Symbol | HOXA1 |
Synonyms | HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1; homeobox 1F; homeo box A1; lab-like protein; Hox 1.6-like protein; homeobox protein Hox-1F; HOX A1 homeodomain protein; BSAS; HOX1; HOX1F; MGC45232; |
Gene ID | 3198 |
mRNA Refseq | NM_005522 |
Protein Refseq | NP_005513 |
MIM | 142955 |
UniProt ID | P49639 |
◆ Recombinant Proteins | ||
HOXA1-3705HF | Recombinant Full Length Human HOXA1 Protein, GST-tagged | +Inquiry |
HOXA1-28508TH | Recombinant Human HOXA1 | +Inquiry |
HOXA1-6949H | Recombinant Human HOXA1 protein, His-tagged | +Inquiry |
HOXA1-4937H | Recombinant Human HOXA1 Protein, GST-tagged | +Inquiry |
HOXA1-2547R | Recombinant Rat HOXA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA1-5430HCL | Recombinant Human HOXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA1 Products
Required fields are marked with *
My Review for All HOXA1 Products
Required fields are marked with *
0
Inquiry Basket