Recombinant Human HOXA1

Cat.No. : HOXA1-28508TH
Product Overview : Recombinant fragment of Human HOXA1 with N-terminal proprietary tag. Predicted MW 37.62kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 109 amino acids
Description : In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region.
Molecular Weight : 37.620kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGD DRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSY SHSSCGPSYGSQNFSAPYSPYALNQEADV
Sequence Similarities : Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.
Gene Name HOXA1 homeobox A1 [ Homo sapiens ]
Official Symbol HOXA1
Synonyms HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1;
Gene ID 3198
mRNA Refseq NM_005522
Protein Refseq NP_005513
MIM 142955
Uniprot ID P49639
Chromosome Location 7p15.2
Function protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXA1 Products

Required fields are marked with *

My Review for All HOXA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon