Recombinant Human HOXA1
Cat.No. : | HOXA1-28508TH |
Product Overview : | Recombinant fragment of Human HOXA1 with N-terminal proprietary tag. Predicted MW 37.62kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 109 amino acids |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. |
Molecular Weight : | 37.620kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGD DRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSY SHSSCGPSYGSQNFSAPYSPYALNQEADV |
Sequence Similarities : | Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name | HOXA1 homeobox A1 [ Homo sapiens ] |
Official Symbol | HOXA1 |
Synonyms | HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1; |
Gene ID | 3198 |
mRNA Refseq | NM_005522 |
Protein Refseq | NP_005513 |
MIM | 142955 |
Uniprot ID | P49639 |
Chromosome Location | 7p15.2 |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HOXA1-2547R | Recombinant Rat HOXA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXA1-4937H | Recombinant Human HOXA1 Protein, GST-tagged | +Inquiry |
HOXA1-3705HF | Recombinant Full Length Human HOXA1 Protein, GST-tagged | +Inquiry |
HOXA1-2892R | Recombinant Rat HOXA1 Protein | +Inquiry |
HOXA1-6949H | Recombinant Human HOXA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXA1-5430HCL | Recombinant Human HOXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA1 Products
Required fields are marked with *
My Review for All HOXA1 Products
Required fields are marked with *
0
Inquiry Basket