Recombinant Full Length Human HOXA1 Protein, GST-tagged

• Cat.No.: HOXA1-3705HF
• Product Overview: Human HOXA1 full-length ORF ( AAH32547, 1 a.a. - 335 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 62.48 kDa
• Protein length: 335 amino acids
• AA Sequence: MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXA1 homeobox A1 [ Homo sapiens ]
• Official Symbol: HOXA1
• Synonyms: HOXA1; homeobox A1; homeo box A1 , HOX1, HOX1F; homeobox protein Hox-A1; homeobox 1F; homeo box A1; lab-like protein; Hox 1.6-like protein; homeobox protein Hox-1F; HOX A1 homeodomain protein; BSAS; HOX1; HOX1F; MGC45232
• Gene ID: 3198
• mRNA Refseq: NM_005522
• Protein Refseq: NP_005513
• MIM: 142955
• UniProt ID: P49639