Recombinant Human HLF, His-tagged
Cat.No. : | HLF-27715TH |
Product Overview : | Recombinant full length Human HLF (amino acids 1-295 ) with a N terminal His tag. 315 amino acids with a predicted MWt 35.3 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 295 amino acids |
Description : | This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Conjugation : | HIS |
Molecular Weight : | 35.300kDa inclusive of tags |
Tissue specificity : | Highly expressed in liver; lower levels in lung and kidney. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEKMSRPLPLNPTFIPPPYG VLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPT VPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIP PSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHP GIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYE PDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKA RKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIA IRASFLEKENSALRQEVADLRKELGKCKNILAKYEARH GPL |
Sequence Similarities : | Belongs to the bZIP family. PAR subfamily.Contains 1 bZIP domain. |
Gene Name | HLF hepatic leukemia factor [ Homo sapiens ] |
Official Symbol | HLF |
Synonyms | HLF; hepatic leukemia factor; MGC33822; |
Gene ID | 3131 |
mRNA Refseq | NM_002126 |
Protein Refseq | NP_002117 |
MIM | 142385 |
Uniprot ID | Q16534 |
Chromosome Location | 17q22 |
Function | DNA binding; double-stranded DNA binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HLF-209H | Recombinant Human HLF protein, T7/His-tagged | +Inquiry |
HLF-3618H | Recombinant Human HLF, His-tagged | +Inquiry |
HLF-5023H | Recombinant Human Hepatic Leukemia Factor, His-tagged | +Inquiry |
HLF-1924R | Recombinant Rhesus Macaque HLF Protein, His (Fc)-Avi-tagged | +Inquiry |
HLF-27715TH | Recombinant Human HLF, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLF-5490HCL | Recombinant Human HLF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLF Products
Required fields are marked with *
My Review for All HLF Products
Required fields are marked with *
0
Inquiry Basket