Recombinant Human HIST1H2AB Protein, GST-tagged

• Cat.No.: HIST1H2AB-4777H
• Product Overview: Human HIST1H2AB full-length ORF ( AAI66650.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 14.3 kDa
• AA Sequence: MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST1H2AB histone cluster 1 H2A family member b [ Homo sapiens (human) ]
• Official Symbol: HIST1H2AB
• Synonyms: HIST1H2AB; histone cluster 1 H2A family member b; H2A/m; H2AFM; histone H2A type 1-B/E; H2A histone family, member M; histone 1, H2ab; histone H2A/m; histone cluster 1, H2ab
• Gene ID: 8335
• mRNA Refseq: NM_003513
• Protein Refseq: NP_003504
• MIM: 602795
• UniProt ID: P04908