Recombinant Full Length Human HIST1H2AB Protein, GST-tagged
Cat.No. : | HIST1H2AB-3568HF |
Product Overview : | Human HIST1H2AB full-length ORF ( AAI66650.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 130 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST1H2AB histone cluster 1 H2A family member b [ Homo sapiens (human) ] |
Official Symbol | HIST1H2AB |
Synonyms | HIST1H2AB; histone cluster 1 H2A family member b; H2A/m; H2AFM; histone H2A type 1-B/E; H2A histone family, member M; histone 1, H2ab; histone H2A/m; histone cluster 1, H2ab |
Gene ID | 8335 |
mRNA Refseq | NM_003513 |
Protein Refseq | NP_003504 |
MIM | 602795 |
UniProt ID | P04908 |
◆ Recombinant Proteins | ||
HIST1H2AB-101H | Recombinant Human HIST1H2AB Protein | +Inquiry |
HIST1H2AB-3568HF | Recombinant Full Length Human HIST1H2AB Protein, GST-tagged | +Inquiry |
HIST1H2AB-90H | Recombinant Human HIST1H2AB/HIST1H2BK Dimer Protein | +Inquiry |
HIST1H2AB-1516H | Recombinant Human HIST1H2AB protein, His & GST-tagged | +Inquiry |
HIST1H2AB-4777H | Recombinant Human HIST1H2AB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H2AB-5549HCL | Recombinant Human HIST1H2AB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST1H2AB Products
Required fields are marked with *
My Review for All HIST1H2AB Products
Required fields are marked with *
0
Inquiry Basket