Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged

• Cat.No.: GFRAL-1929H
• Product Overview: Recombinant Human GFRAL Protein (19-351 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 19-351 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.8 kDa
• AA Sequence: SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.
• Publications:
  Secreted GDF15 maintains transcriptional responses during DNA damage-mediated senescence in human beta cells (2024)

Gene Information

• Gene Name: GFRAL GDNF family receptor alpha like [ Homo sapiens ]
• Official Symbol: GFRAL
• Synonyms: GFRAL; bA360D14.1; GRAL; UNQ9356; IVFI9356; C6orf144
• Gene ID: 389400
• mRNA Refseq: NM_207410
• Protein Refseq: NP_997293
• UniProt ID: Q6UXV0