Description :	This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	35.64 kDa
AA Sequence :	LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	GDF7 growth differentiation factor 7 [ Homo sapiens ]
Official Symbol	GDF7
Synonyms	GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7;
Gene ID	151449
mRNA Refseq	NM_182828
Protein Refseq	NP_878248
MIM	604651
UniProt ID	Q7Z4P5