Recombinant Human GDF7 protein
Cat.No. : | GDF7-28992TH |
Product Overview : | Recombinant Human GDF7 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 129 |
Description : | Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
Molecular Mass : | Approximately 28.0 kDa, a disulfide-linked homodimeric protein containing two 129 amino acids. |
AA Sequence : | TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Endotoxin : | Less than 0.1 EU/µg of rHuGDF-7/BMP-12 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | GDF7 |
Official Symbol | GDF7 |
Synonyms | GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7; |
Gene ID | 151449 |
mRNA Refseq | NM_182828 |
Protein Refseq | NP_878248 |
MIM | 604651 |
UniProt ID | Q7Z4P5 |
◆ Recombinant Proteins | ||
GDF7-051H | Active Recombinant Human GDF7 Protein | +Inquiry |
GDF7-3522M | Recombinant Mouse GDF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF7-4828H | Recombinant Human GDF7 Protein, GST-tagged | +Inquiry |
Gdf7-279M | Recombinant Mouse Gdf7 Protein, His-tagged | +Inquiry |
GDF7-2200H | Recombinant Human GDF7 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF7 Products
Required fields are marked with *
My Review for All GDF7 Products
Required fields are marked with *
0
Inquiry Basket