Recombinant Human GDF7 protein

• Cat.No.: GDF7-28992TH
• Product Overview: Recombinant Human GDF7 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• ProteinLength: 129
• Description: Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
• Molecular Mass: Approximately 28.0 kDa, a disulfide-linked homodimeric protein containing two 129 amino acids.
• AA Sequence: TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
• Endotoxin: Less than 0.1 EU/µg of rHuGDF-7/BMP-12 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: GDF7
• Official Symbol: GDF7
• Synonyms: GDF7; growth differentiation factor 7; growth/differentiation factor 7; BMP12; GDF-7
• Gene ID: 151449
• mRNA Refseq: NM_182828
• Protein Refseq: NP_878248
• MIM: 604651
• UniProt ID: Q7Z4P5