Recombinant Human FCER2 protein(48-248aa), His-tagged

• Cat.No.: FCER2-3811H
• Product Overview: Recombinant Human FCER2 protein(P06734)(48-248aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 48-248aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG

Gene Information

• Gene Name: FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens ]
• Official Symbol: FCER2
• Synonyms: FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF
• Gene ID: 2208
• mRNA Refseq: NM_001207019
• Protein Refseq: NP_001193948
• MIM: 151445
• UniProt ID: P06734