Recombinant Human FCER2 Protein, GST-tagged

• Cat.No.: FCER2-3985H
• Product Overview: Human FCER2 full-length ORF ( AAH14108, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
• Molecular Mass: 61.05 kDa
• AA Sequence: MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens ]
• Official Symbol: FCER2
• Synonyms: FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF
• Gene ID: 2208
• mRNA Refseq: NM_001207019
• Protein Refseq: NP_001193948
• MIM: 151445
• UniProt ID: P06734