Recombinant Human FAU Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : FAU-262H
Product Overview : FAU MS Standard C13 and N15-labeled recombinant protein (NP_001988) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. [provided by RefSeq, Nov 2014]
Molecular Mass : 14.2 kDa
AA Sequence : MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAU Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed [ Homo sapiens (human) ]
Official Symbol FAU
Synonyms FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived); ubiquitin-like protein fubi and ribosomal protein S30; asr1; FLJ22986; Fub1; Fubi; MNSFbeta; Monoclonal nonspecific suppressor factor beta; ribosomal protein S30; RPS30; S30; 40S ribosomal protein S30; ubiquitin-like-S30 fusion protein; FAU-encoded ubiquitin-like protein; FBR-MuSV-associated ubiquitously expressed; monoclonal nonspecific suppressor factor beta; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); FAU1;
Gene ID 2197
mRNA Refseq NM_001997
Protein Refseq NP_001988
MIM 134690
UniProt ID P35544

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAU Products

Required fields are marked with *

My Review for All FAU Products

Required fields are marked with *

0

Inquiry Basket

cartIcon