Recombinant Mouse Fau protein, His&Myc-tagged
Cat.No. : | Fau-733M |
Product Overview : | Recombinant Mouse Fau protein(P35545)(1-74aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-74a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG |
Gene Name | Fau Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived) [ Mus musculus ] |
Official Symbol | Fau |
Synonyms | FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); 40S ribosomal protein S30; MNSF-beta; ubiquitin-like protein FUBI; monoclonal non-specific suppressor factor beta; monoclonal nonspecific suppressor factor betamonoclonal nonspecific suppressor factor beta; MNSFbeta; |
Gene ID | 14109 |
mRNA Refseq | NM_001160239 |
Protein Refseq | NP_001153711 |
◆ Recombinant Proteins | ||
FAU-12760H | Recombinant Human FAU, GST-tagged | +Inquiry |
FAU-5696M | Recombinant Mouse FAU Protein | +Inquiry |
FAU-3128M | Recombinant Mouse FAU Protein, His (Fc)-Avi-tagged | +Inquiry |
FAU-4875HF | Recombinant Full Length Human FAU Protein, GST-tagged | +Inquiry |
FAU-1471R | Recombinant Rhesus Macaque FAU Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAU-6320HCL | Recombinant Human FAU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fau Products
Required fields are marked with *
My Review for All Fau Products
Required fields are marked with *
0
Inquiry Basket