Recombinant Mouse Fau protein, His&Myc-tagged

• Cat.No.: Fau-733M
• Product Overview: Recombinant Mouse Fau protein(P35545)(1-74aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: His&Myc
• Protein length: 1-74a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.2 kDa
• AASequence: MQLFVRAQELHTLEVTGQETVAQIKDHVASLEGIAPEDQVVLLAGSPLEDEATLGQCGVEALTTLEVAGRMLGG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Fau Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived) [ Mus musculus ]
• Official Symbol: Fau
• Synonyms: FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); 40S ribosomal protein S30; MNSF-beta; ubiquitin-like protein FUBI; monoclonal non-specific suppressor factor beta; monoclonal nonspecific suppressor factor betamonoclonal nonspecific suppressor factor beta; MNSFbeta
• Gene ID: 14109
• mRNA Refseq: NM_001160239
• Protein Refseq: NP_001153711