Recombinant Full Length Human FAU Protein
Cat.No. : | FAU-163HF |
Product Overview : | Recombinant full length Human FAU with N-terminal proprietary tag, 40.37 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 133 amino acids |
Description : | This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. |
Form : | Liquid |
Molecular Mass : | 40.370kDa inclusive of tags |
AA Sequence : | MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQV VLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSL ARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV PTFGKKKGPNANS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | FAU Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed [ Homo sapiens ] |
Official Symbol | FAU |
Synonyms | FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived); ubiquitin-like protein fubi and ribosomal protein S30; asr1; FLJ22986; Fub1; Fubi |
Gene ID | 2197 |
mRNA Refseq | NM_001997 |
Protein Refseq | NP_001988 |
MIM | 134690 |
UniProt ID | P35544 |
◆ Recombinant Proteins | ||
FAU-4875HF | Recombinant Full Length Human FAU Protein, GST-tagged | +Inquiry |
FAU-5696M | Recombinant Mouse FAU Protein | +Inquiry |
Fau-733M | Recombinant Mouse Fau protein, His&Myc-tagged | +Inquiry |
FAU-1471R | Recombinant Rhesus Macaque FAU Protein, His (Fc)-Avi-tagged | +Inquiry |
FAU-3866H | Recombinant Human FAU Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAU-6320HCL | Recombinant Human FAU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAU Products
Required fields are marked with *
My Review for All FAU Products
Required fields are marked with *
0
Inquiry Basket