Recombinant Human FABP2 protein

• Cat.No.: FABP2-3630H
• Product Overview: Recombinant Human FABP2 protein was expressed in Escherichia coli.

Specification

• Description: The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Molecular Mass: Approximately 15.1 kDa, a single non-glycosylated polypeptide chain containing 131 amino acids.
• Protein length: 131
• AA Sequence: AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
• Endotoxin: Less than 0.1 EU/µg of rHuFABP2 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: FABP2
• Official Symbol: FABP2
• Synonyms: FABP2; fatty acid binding protein 2, intestinal; fatty acid-binding protein, intestinal; I FABP; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein; FABPI; I-FABP; MGC133132
• Gene ID: 2169
• mRNA Refseq: NM_000134
• Protein Refseq: NP_000125
• MIM: 134640
• UniProt ID: P12104