Recombinant Human FABP2 Protein, GST-tagged

• Cat.No.: FABP2-3631H
• Product Overview: Human FABP2 full-length ORF (1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis. [provided by RefSeq, Aug 2017]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.32 kDa
• AA Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGINSQSKNQALFETLKLFLNLVSPLITT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FABP2 fatty acid binding protein 2, intestinal [ Homo sapiens ]
• Official Symbol: FABP2
• Synonyms: FABP2; fatty acid binding protein 2, intestinal; fatty acid-binding protein, intestinal; I FABP; fatty acid-binding protein 2; intestinal-type fatty acid-binding protein; FABPI; I-FABP; MGC133132
• Gene ID: 2169
• mRNA Refseq: NM_000134
• Protein Refseq: NP_000125
• MIM: 134640
• UniProt ID: P12104