Recombinant Human ETF1

• Cat.No.: ETF1-28695TH
• Product Overview: Recombinant fragment of Human eRF1 with N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
• Sequence Similarities: Belongs to the eukaryotic release factor 1 family.

Gene Information

• Gene Name: ETF1 eukaryotic translation termination factor 1 [ Homo sapiens ]
• Official Symbol: ETF1
• Synonyms: ETF1; eukaryotic translation termination factor 1; ERF, ERF1, SUP45L1; eukaryotic peptide chain release factor subunit 1; eRF1; polypeptide chain release factor 1; RF1; sup45 (yeast omnipotent suppressor 45) homolog like 1; TB3 1
• Gene ID: 2107
• mRNA Refseq: NM_004730
• Protein Refseq: NP_004721
• MIM: 600285
• Uniprot ID: P62495
• Chromosome Location: 5q31.2
• Pathway: Eukaryotic Translation Termination, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem
• Function: RNA binding; protein binding; ribosome binding; translation release factor activity; translation release factor activity, codon specific