Recombinant Human EPOR protein(25-250aa), His-tagged

• Cat.No.: EPOR-3851H
• Product Overview: Recombinant Human EPOR protein(P19235)(25-250aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• Protein length: 1-250 a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.6 kDa
• AASequence: APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: EPOR erythropoietin receptor [ Homo sapiens ]
• Official Symbol: EPOR
• Synonyms: EPOR; erythropoietin receptor; EPO-R; MGC138358
• Gene ID: 2057
• mRNA Refseq: NM_000121
• Protein Refseq: NP_000112
• MIM: 133171
• UniProt ID: P19235