Recombinant Human EPHB6 Protein, GST-tagged

• Cat.No.: EPHB6-3406H
• Product Overview: Human EPHB6 partial ORF ( NP_004436, 23 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Molecular Mass: 36.63 kDa
• AA Sequence: DTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQAEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EPHB6 EPH receptor B6 [ Homo sapiens ]
• Official Symbol: EPHB6
• Synonyms: EPHB6; EPH receptor B6; EphB6; ephrin type-B receptor 6; HEP; tyrosine-protein kinase-defective receptor EPH-6; MGC129910; MGC129911
• Gene ID: 2051
• mRNA Refseq: NM_004445
• Protein Refseq: NP_004436
• MIM: 602757
• UniProt ID: O15197