Recombinant Human ENOPH1 protein, GST-tagged

Cat.No. : ENOPH1-8433H
Product Overview : Recombinant Human ENOPH1 protein(1-115 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-115 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol ENOPH1
Synonyms ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA; MASA homolog; 2,3-diketo-5-methylthio-1-phosphopentane phosphatase; MST145; FLJ12594; DKFZp586M0524;
Gene ID 58478
mRNA Refseq NM_021204
Protein Refseq NP_067027
UniProt ID Q9UHY7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ENOPH1 Products

Required fields are marked with *

My Review for All ENOPH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon