Recombinant Human ENOPH1 protein, GST-tagged

• Cat.No.: ENOPH1-84332H
• Product Overview: Recombinant Human ENOPH1 protein(1-261 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-261 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: ENOPH1
• Synonyms: ENOPH1; enolase-phosphatase 1; enolase-phosphatase E1; acireductone synthase; E1; Enolase phosphatase E1; MASA; MASA homolog; 2,3-diketo-5-methylthio-1-phosphopentane phosphatase; MST145; FLJ12594; DKFZp586M0524
• Gene ID: 58478
• mRNA Refseq: NM_021204
• Protein Refseq: NP_067027
• UniProt ID: Q9UHY7