Recombinant Human EIF2AK4 Protein, GST-tagged

• Cat.No.: EIF2AK4-3153H
• Product Overview: Human EIF2AK4 partial ORF ( NP_001013725, 1401 a.a. - 1500 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2), resulting in the downregulaton of protein synthesis. The encoded protein responds to amino acid deprivation by binding uncharged transfer RNAs. It may also be activated by glucose deprivation and viral infection. Mutations in this gene have been found in individuals suffering from autosomal recessive pulmonary venoocclusive-disease-2. [provided by RefSeq, Mar 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: VVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQEYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ]
• Official Symbol: EIF2AK4
• Synonyms: EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; GCN2-like protein; GCN2 eIF2alpha kinase
• Gene ID: 440275
• mRNA Refseq: NM_001013703
• Protein Refseq: NP_001013725
• MIM: 609280
• UniProt ID: Q9P2K8