Recombinant Full Length Human EIF2AK4 Protein, GST-tagged
Cat.No. : | EIF2AK4-4488HF |
Product Overview : | Human ERC1 full-length ORF ( AAH05065.1, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 91 amino acids |
Description : | This gene encodes a member of a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2), resulting in the downregulaton of protein synthesis. The encoded protein responds to amino acid deprivation by binding uncharged transfer RNAs. It may also be activated by glucose deprivation and viral infection. Mutations in this gene have been found in individuals suffering from autosomal recessive pulmonary venoocclusive-disease-2. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQEYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ] |
Official Symbol | EIF2AK4 |
Synonyms | EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338; GCN2-like protein; GCN2 eIF2alpha kinase; |
Gene ID | 440275 |
mRNA Refseq | NM_001013703 |
Protein Refseq | NP_001013725 |
MIM | 609280 |
UniProt ID | Q9P2K8 |
◆ Recombinant Proteins | ||
EIF2AK4-3346H | Recombinant Human EIF2AK4 protein, His-tagged | +Inquiry |
EIF2AK4-1414H | Recombinant Human EIF2AK4 Protein, His-tagged | +Inquiry |
EIF2AK4-1011H | Recombinant Human Eukaryotic Translation Initiation Factor 2 Alpha Kinase 4, GST-tagged | +Inquiry |
EIF2AK4-28160TH | Recombinant Human EIF2AK4 | +Inquiry |
EIF2AK4-5078M | Recombinant Mouse EIF2AK4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2AK4-6672HCL | Recombinant Human EIF2AK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2AK4 Products
Required fields are marked with *
My Review for All EIF2AK4 Products
Required fields are marked with *
0
Inquiry Basket