Recombinant Human EIF2AK4

• Cat.No.: EIF2AK4-28160TH
• Product Overview: Recombinant fragment of Human GCN2 with proprietary tag, 36.63kDa.

Specification

• Description: EIF2AK4 belongs to a family of kinases that phosphorylate the alpha subunit of eukaryotic translation initiation factor-2 (EIF2S1; MIM 603907) to downregulate protein synthesis in response to varied cellular stresses (Berlanga et al.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Widely expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YETQVQTRLQTSLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVCDEIYNIKVEKKVSVLFLYSYRDDYYRILF
• Sequence Similarities: Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.Contains 2 protein kinase domains.Contains 1 RWD domain.
• Tag: Non

Gene Information

• Gene Name: EIF2AK4 eukaryotic translation initiation factor 2 alpha kinase 4 [ Homo sapiens ]
• Official Symbol: EIF2AK4
• Synonyms: EIF2AK4; eukaryotic translation initiation factor 2 alpha kinase 4; eukaryotic translation initiation factor 2-alpha kinase 4; GCN2; KIAA1338
• Gene ID: 440275
• mRNA Refseq: NM_001013703
• Protein Refseq: NP_001013725
• MIM: 609280
• Uniprot ID: Q9P2K8
• Chromosome Location: 15q13.3
• Pathway: Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Influenza A, organism-specific biosystem
• Function: ATP binding; aminoacyl-tRNA ligase activity; eukaryotic translation initiation factor 2alpha kinase activity; nucleotide binding; protein homodimerization activity