Recombinant Human DST Protein, His-SUMO-tagged

Cat.No. : DST-1196H
Product Overview : Recombinant Human DST Protein (1-195aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 39.1 kDa
AA Sequence : MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEMLQQIANRVQRD
SVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRV
AKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Protein length : 1-195 a.a.
Gene Name DST dystonin [ Homo sapiens ]
Official Symbol DST
Synonyms DT; BPA; DMH; BP240; BPAG1; EBSB2; HSAN6; MACF2; CATX15; CATX-15; D6S1101
Gene ID 667
mRNA Refseq NM_001723.5
Protein Refseq NP_001714.1
MIM 113810
UniProt ID Q03001

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DST Products

Required fields are marked with *

My Review for All DST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon