Recombinant Human DSCR4 Protein, GST-tagged

• Cat.No.: DSCR4-2885H
• Product Overview: Human DSCR4 full-length ORF ( ADR82732.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. [provided by RefSeq, Jan 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 13 kDa
• AA Sequence: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DSCR4 Down syndrome critical region gene 4 [ Homo sapiens ]
• Official Symbol: DSCR4
• Synonyms: DSCR4; Down syndrome critical region gene 4; DCRB; DSCRB
• Gene ID: 10281
• mRNA Refseq: NM_005867
• Protein Refseq: NP_005858
• MIM: 604829
• UniProt ID: P56555