Recombinant Full Length Human DSCR4 Protein, GST-tagged

Cat.No. : DSCR4-4199HF
Product Overview : Human DSCR4 full-length ORF ( ADR82732.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 118 amino acids
Description : The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus. [provided by RefSeq, Jan 2015]
Molecular Mass : 13 kDa
AA Sequence : MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DSCR4 Down syndrome critical region gene 4 [ Homo sapiens ]
Official Symbol DSCR4
Synonyms DSCR4; Down syndrome critical region gene 4; DCRB; DSCRB
Gene ID 10281
mRNA Refseq NM_005867
Protein Refseq NP_005858
MIM 604829
UniProt ID P56555

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DSCR4 Products

Required fields are marked with *

My Review for All DSCR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon