Recombinant Human DSCR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DSCR4-1902H
Product Overview : DSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_005858) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus.
Molecular Mass : 13 kDa
AA Sequence : MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DSCR4 Down syndrome critical region gene 4 [ Homo sapiens (human) ]
Official Symbol DSCR4
Synonyms DSCR4; Down syndrome critical region 4; DCRB; DSCRB; Down syndrome critical region gene 4; Down syndrome critical region protein 4; Down syndrome critical region protein B; AP001415.1
Gene ID 10281
mRNA Refseq NM_005867
Protein Refseq NP_005858
MIM 604829
UniProt ID P56555

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DSCR4 Products

Required fields are marked with *

My Review for All DSCR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon