Recombinant Human DSCR4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DSCR4-1902H
• Product Overview: DSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_005858) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The gene is found in a region of chromosome 21 that has been linked to the pathogenesis of Down syndrome. This gene is transcribed from a bi-directional promoter located in an endogenous retrovirus.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13 kDa
• AA Sequence: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DSCR4 Down syndrome critical region gene 4 [ Homo sapiens (human) ]
• Official Symbol: DSCR4
• Synonyms: DSCR4; Down syndrome critical region 4; DCRB; DSCRB; Down syndrome critical region gene 4; Down syndrome critical region protein 4; Down syndrome critical region protein B; AP001415.1
• Gene ID: 10281
• mRNA Refseq: NM_005867
• Protein Refseq: NP_005858
• MIM: 604829
• UniProt ID: P56555