Recombinant Human DOCK8 Protein (560-729 aa), His-tagged

Cat.No. : DOCK8-2255H
Product Overview : Recombinant Human DOCK8 Protein (560-729 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 560-729 aa
Description : Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity by controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.3 kDa
AA Sequence : RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name DOCK8 dedicator of cytokinesis 8 [ Homo sapiens (human) ]
Official Symbol DOCK8
Synonyms DOCK8; MRD2; ZIR8; HEL-205;
Gene ID 81704
mRNA Refseq NM_001190458
Protein Refseq NP_001177387
UniProt ID Q8NF50

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DOCK8 Products

Required fields are marked with *

My Review for All DOCK8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon