Recombinant Human DMBT1

• Cat.No.: DMBT1-26786TH
• Product Overview: Recombinant fragment of Human gp340 (aa 1377-1485) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa, inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 109 amino acids
• Description: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers.The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line.DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized.The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID).Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition.This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
• Molecular Weight: 37.620kDa inclusive of tags
• Tissue specificity: Highly expressed in alveolar and macrophage tissues. In some macrophages, expression is seen on the membrane, and in other macrophages, strongly expressed in the phagosome/phagolysosome compartments. Expressed in lung, trachea, salivary gland, small intes
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNY RVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGA RGSFTSSSNFMSIRFISDHSITRRGFRAE
• Sequence Similarities: Belongs to the DMBT1 family.Contains 2 CUB domains.Contains 14 SRCR domains.Contains 1 ZP domain.

Gene Information

• Gene Name: DMBT1 deleted in malignant brain tumors 1 [ Homo sapiens ]
• Official Symbol: DMBT1
• Synonyms: DMBT1; deleted in malignant brain tumors 1; deleted in malignant brain tumors 1 protein; GP340; muclin
• Gene ID: 1755
• mRNA Refseq: NM_004406
• Protein Refseq: NP_004397
• MIM: 601969
• Uniprot ID: Q9UGM3
• Chromosome Location: 10q25.3-q26.1
• Pathway: Salivary secretion, organism-specific biosystem; Salivary secretion, conserved biosystem
• Function: Gram-negative bacterial cell surface binding; Gram-positive bacterial cell surface binding; calcium-dependent protein binding; pattern recognition receptor activity; scavenger receptor activity