Recombinant Human DMBT1 Protein, GST-tagged

• Cat.No.: DMBT1-2700H
• Product Overview: Human DMBT1 partial ORF ( NP_004397, 1377 a.a. - 1485 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. This gene was originally isolated based on its deletion in a medulloblastoma cell line. This gene is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The encoded protein precursor is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor suppressor gene, but rather play a role in the interaction of tumor cells and the immune system. [provided by RefSeq, Mar 2016]
• Molecular Mass: 37.73 kDa
• AA Sequence: DYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFISDHSITRRRFRAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMBT1 deleted in malignant brain tumors 1 [ Homo sapiens ]
• Official Symbol: DMBT1
• Synonyms: DMBT1; deleted in malignant brain tumors 1; deleted in malignant brain tumors 1 protein; GP340; muclin; SAG; gp-340; hensin; glycoprotein 340; salivary agglutinin; surfactant pulmonary-associated D-binding protein; FLJ61058; MGC164738
• Gene ID: 1755
• mRNA Refseq: NM_004406
• Protein Refseq: NP_004397
• MIM: 601969
• UniProt ID: Q9UGM3