Recombinant Human CYP51A1 Protein, GST-tagged

• Cat.No.: CYP51A1-2290H
• Product Overview: Human CYP51A1 partial ORF ( NP_000777, 410 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]
• Molecular Mass: 36.74 kDa
• AA Sequence: SPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYP51A1 cytochrome P450, family 51, subfamily A, polypeptide 1 [ Homo sapiens ]
• Official Symbol: CYP51A1
• Synonyms: CP51; CP51A_HUMAN; CYP51; CYP51A1; CYPLI; Cytochrome P450 51; Cytochrome P450 51A1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Lanosterol 14-alpha demethylase; LDM; P450 14DM; P450L1; Sterol 14-alpha demethylase
• Gene ID: 1595
• mRNA Refseq: NM_000786.3
• Protein Refseq: NP_000777.1
• MIM: 601637
• UniProt ID: Q16850