Recombinant Full Length Bovine Lanosterol 14-Alpha Demethylase(Cyp51A1) Protein, His-Tagged
Cat.No. : | RFL10948BF |
Product Overview : | Recombinant Full Length Bovine Lanosterol 14-alpha demethylase(CYP51A1) Protein (Q4PJW3) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MLDLLQAGGSVLGQAMEQVTGGNLASMLLIACAFTLSLVYLFRLAVGHLAPPLPTGAKSP PYIVSPIPFLGHAIAFGKSPIEFLEDAYEKYGPVFSFTMVGKTFTYLLGSEAAALLFNSK NEDLNAEEVYSRLTTPVFGKGVAYDVPNTVFLEQKKMLKSGLNIAHFRQHVSIIEKETKE YFKSWGESGEKNLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLL PGWLPLPSFRRRDRAHREIKNIFYKAIQKRRESGEKIDDILQTLLESTYKDGRPLTDDEV AGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCFLEQKTVCGENLPPLTYDQLKDLN LLDRCIKETLRLRPPIMTMMRLAKTPLTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDF NPDRYLEDSPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPT VNYTTMIHTPEKPIIRYKRRSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP51A1 |
Synonyms | CYP51A1; Lanosterol 14-alpha demethylase; LDM; CYPLI; Cytochrome P450 51A1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Sterol 14-alpha demethylase |
UniProt ID | Q4PJW3 |
◆ Recombinant Proteins | ||
Rassf4-5396M | Recombinant Mouse Rassf4 Protein, Myc/DDK-tagged | +Inquiry |
EID2-2693M | Recombinant Mouse EID2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT61B-1377HFL | Recombinant Full Length Human TRMT61B Protein, C-Flag-tagged | +Inquiry |
SPIC-1340Z | Recombinant Zebrafish SPIC | +Inquiry |
VP4-5733R | Recombinant Rotavirus X VP4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC3-27333TH | Native Human APOC3 | +Inquiry |
F2-90B | Active Native Bovine Thrombin | +Inquiry |
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC87-7744HCL | Recombinant Human CCDC87 293 Cell Lysate | +Inquiry |
CLIP2-365HCL | Recombinant Human CLIP2 cell lysate | +Inquiry |
RHOA-601HCL | Recombinant Human RHOA cell lysate | +Inquiry |
C12orf57-8313HCL | Recombinant Human C12orf57 293 Cell Lysate | +Inquiry |
Thymus-657B | Bovine Thymus Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP51A1 Products
Required fields are marked with *
My Review for All CYP51A1 Products
Required fields are marked with *
0
Inquiry Basket