Recombinant Human COL1A1 protein, His-tagged
Cat.No. : | COL1A1-01H |
Product Overview : | Recombinant Human COL1A1 protein, fused to His-tag, was expressed in HEK293. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1464 aa |
Description : | This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. |
Form : | Liquid |
AA Sequence : | QLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRAGGGGSHHHHHH |
Purity : | > 95 % |
Storage : | Store at -20 centigrade to -80 centigrade |
Storage Buffer : | PBS, pH 6.8 |
Gene Name | COL1A1 collagen type I alpha 1 chain [ Homo sapiens (human) ] |
Official Symbol | COL1A1 |
Synonyms | OI1; OI2; OI3; OI4; EDSC; CAFYD; EDSARTH1 |
Gene ID | 1277 |
mRNA Refseq | NM_000088 |
Protein Refseq | NP_000079 |
MIM | 120150 |
UniProt ID | P02452 |
◆ Recombinant Proteins | ||
COL1A1-114H | Active Recombinant Human collagen type I alpha 1 chain Protein, His tagged | +Inquiry |
COL1A1-1206H | Recombinant Human Collagen, Type I, Alpha 1 | +Inquiry |
Col1a1-09M | Recombinant Mouse Col1a1 protein, His-tagged | +Inquiry |
COL1A1-1517R | Recombinant Rat COL1A1 Protein | +Inquiry |
Col1a1-1277M | Recombinant Mouse Col1a1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL1A1 Products
Required fields are marked with *
My Review for All COL1A1 Products
Required fields are marked with *
0
Inquiry Basket