Recombinant Human COL1A1 protein
Cat.No. : | COL1A1-71H |
Product Overview : | Recombinant Human collagen-I CBF8 domain cDNA fragment (26 - 542 aa) fused with N-terminal fusion of human VTN (61-398aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 26-542 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFGPAGPPGRDGIPGQPGLPGPPGPP GPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGP PGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGA PGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGE PGPPGPAGAAGPAGNPGADGQPGAKGANGA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human hepatocytes differentiation ascoating matrix protein.2. May be used as culture matrix protein for long term liver cells cultivation in vitro. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | COL1A1 collagen, type I, alpha 1 [ Homo sapiens ] |
Official Symbol | COL1A1 |
Synonyms | COL1A1; collagen, type I, alpha 1; collagen alpha-1(I) chain; OI4; alpha-1 type I collagen; pro-alpha-1 collagen type 1; collagen alpha 1 chain type I; collagen alpha-1(I) chain preproprotein; collagen of skin, tendon and bone, alpha-1 chain; |
Gene ID | 1277 |
mRNA Refseq | NM_000088 |
Protein Refseq | NP_000079 |
MIM | |
UniProt ID | P02452 |
Chromosome Location | 17q21.33 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Axon guidance, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; |
Function | extracellular matrix structural constituent; identical protein binding; platelet-derived growth factor binding; protein binding; |
◆ Recombinant Proteins | ||
Col1a1-1276R | Recombinant Rat Col1a1 Protein, His&GST-tagged | +Inquiry |
COL1A1-1761H | Recombinant Human COL1A1 Protein (Gly1094-Leu1464), His tagged | +Inquiry |
COL1A1-67H | Recombinant Human COL1A1 protein, His-tagged | +Inquiry |
COL1A1-2523H | Recombinant Human COL1A1 protein(1021-1110 aa), C-His-tagged | +Inquiry |
Col1a1-1277M | Recombinant Mouse Col1a1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL1A1 Products
Required fields are marked with *
My Review for All COL1A1 Products
Required fields are marked with *
0
Inquiry Basket